Overview

  • Product name

    Anti-SLC1A5/ASCT2 antibody
    See all SLC1A5/ASCT2 primary antibodies
  • Description

    Rabbit polyclonal to SLC1A5/ASCT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Orangutan
  • Immunogen

    Synthetic peptide within Human SLC1A5/ASCT2 aa 450-500. The exact sequence is proprietary. (NP_005619.1).
    Sequence:

    VDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELI Q


    Database link: Q15758

  • Positive control

    • HeLa, 293T and Jurkat whole cell lysate (ab7899).
  • General notes

     This product was previously labelled as SLC1A5

     

Properties

Applications

Our Abpromise guarantee covers the use of ab187692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 56 kDa.

Target

  • Function

    Sodium-dependent amino acids transporter that has a broad substrate specificity, with a preference for zwitterionic amino acids. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated, anionic, and cationic amino acids. May also be activated by insulin. Through binding of the fusogenic protein syncytin-1/ERVW-1 may mediate trophoblasts syncytialization, the spontaneous fusion of their plasma membranes, an essential process in placental development (PubMed:10708449, PubMed:23492904). Acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses (PubMed:10051606, PubMed:10196349).
  • Tissue specificity

    Placenta, lung, skeletal muscle, kidney, pancreas, and intestine.
  • Sequence similarities

    Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. SLC1A5 subfamily.
  • Cellular localization

    Cell membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • ASCT2 antibody
    • AAAT antibody
    • AAAT_HUMAN antibody
    • ATB(0) antibody
    • ATBO antibody
    • Baboon M7 virus receptor antibody
    • FLJ31068 antibody
    • M7V1 antibody
    • M7VS1 antibody
    • Neutral amino acid transporter B(0) antibody
    • R16 antibody
    • RD114/simian type D retrovirus receptor antibody
    • RDR antibody
    • RDRC antibody
    • SLC1A5 antibody
    • Sodium dependent neutral amino acid transporter type 2 antibody
    • Sodium-dependent neutral amino acid transporter type 2 antibody
    • Solute carrier family 1 (neutral amino acid transporter), member 5 antibody
    • Solute carrier family 1 member 5 antibody
    see all

Images

  • All lanes : Anti-SLC1A5/ASCT2 antibody (ab187692) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 56 kDa


    Exposure time: 3 minutes
  • Detection of SLC1A5/ASCT2 in Immunoprecipitates of 293T whole cell lysate (1 mg for IP, 20% of IP loaded) using ab187692 at 6 µg/mg lysate for IP and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 30 seconds.

References

This product has been referenced in:

  • Huang X  et al. The HGF-MET axis coordinates liver cancer metabolism and autophagy for chemotherapeutic resistance. Autophagy 15:1258-1279 (2019). Read more (PubMed: 30786811) »
  • Sen N  et al. EWS-FLI1 reprograms the metabolism of Ewing sarcoma cells via positive regulation of glutamine import and serine-glycine biosynthesis. Mol Carcinog 57:1342-1357 (2018). Read more (PubMed: 29873416) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up