Overview

  • Product name

    Anti-SLC1A5/ASCT2 antibody
    See all SLC1A5/ASCT2 primary antibodies
  • Description

    Rabbit polyclonal to SLC1A5/ASCT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human SLC1A5/ASCT2 aa 217-266 (internal sequence).
    Sequence:

    RVKVPVGQEVEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNEAT

  • Positive control

    • Jurkat cell lysate, human kidney tissue.
  • General notes

    Did not detect any signal in HepG2 cell lysate with ab58690 in WB.

     This product was previously labelled as SLC1A5

     

Properties

Applications

Our Abpromise guarantee covers the use of ab58690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 54 kDa (predicted molecular weight: 57 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function

    Sodium-dependent amino acids transporter that has a broad substrate specificity, with a preference for zwitterionic amino acids. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated, anionic, and cationic amino acids. May also be activated by insulin. Through binding of the fusogenic protein syncytin-1/ERVW-1 may mediate trophoblasts syncytialization, the spontaneous fusion of their plasma membranes, an essential process in placental development (PubMed:10708449, PubMed:23492904). Acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses (PubMed:10051606, PubMed:10196349).
  • Tissue specificity

    Placenta, lung, skeletal muscle, kidney, pancreas, and intestine.
  • Sequence similarities

    Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. SLC1A5 subfamily.
  • Cellular localization

    Cell membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • ASCT2 antibody
    • AAAT antibody
    • AAAT_HUMAN antibody
    • ATB(0) antibody
    • ATBO antibody
    • Baboon M7 virus receptor antibody
    • FLJ31068 antibody
    • M7V1 antibody
    • M7VS1 antibody
    • Neutral amino acid transporter B(0) antibody
    • R16 antibody
    • RD114/simian type D retrovirus receptor antibody
    • RDR antibody
    • RDRC antibody
    • SLC1A5 antibody
    • Sodium dependent neutral amino acid transporter type 2 antibody
    • Sodium-dependent neutral amino acid transporter type 2 antibody
    • Solute carrier family 1 (neutral amino acid transporter), member 5 antibody
    • Solute carrier family 1 member 5 antibody
    see all

Images

  • Anti-SLC1A5/ASCT2 antibody (ab58690) at 2.5 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 57 kDa
    Observed band size: 54 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling SLC1A5/ASCT2 with ab58690 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the renal tubule. Magnification: 400X.

References

This product has been referenced in:

  • Tanaka S  et al. KAP1 Regulates Regulatory T Cell Function and Proliferation in Both Foxp3-Dependent and -Independent Manners. Cell Rep 23:796-807 (2018). Read more (PubMed: 29669285) »
  • Lee CH  et al. Discovery of a diagnostic biomarker for colon cancer through proteomic profiling of small extracellular vesicles. BMC Cancer 18:1058 (2018). Read more (PubMed: 30382917) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab58690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up