Overview

  • Product name

    Anti-SLC22A11/OAT4 antibody
    See all SLC22A11/OAT4 primary antibodies
  • Description

    Rabbit polyclonal to SLC22A11/OAT4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC22A11/OAT4 aa 40-150.
    Sequence:

    FSAAIPGHRCWTHMLDNGSAVSTNMTPKALLTISIPPGPNQGPHQCRRFR QPQWQLLDPNATATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQ GLKPLSQSIFM


    Database link: Q9NSA0

  • Positive control

    • IHC-P: Human kidney and placenta tissues.
  • General notes

     This product was previously labelled as SLC22A11

     

Properties

Applications

Our Abpromise guarantee covers the use of ab229804 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Mediates saturable uptake of estrone sulfate, dehydroepiandrosterone sulfate and related compounds.
  • Tissue specificity

    Detected in placenta and kidney.
  • Sequence similarities

    Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family.
  • Post-translational
    modifications

    N-glycosylated. Contains several complex-type N-glycans.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • hOAT4 antibody
    • MGC34282 antibody
    • OAT4 antibody
    • Organic anion transporter 4 antibody
    • S22AB_HUMAN antibody
    • SLC22A11 antibody
    • Solute carrier family 22 (organic anion/urate transporter) member 11 antibody
    • Solute carrier family 22 member 11 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for SLC22A11/OAT4 using ab229804 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for SLC22A11/OAT4 using ab229804 at 1/100 dilution in immunohistochemical analysis.

References

ab229804 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229804.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up