Overview

  • Product name

    Anti-SLC22A13 antibody - C-terminal
  • Description

    Rabbit polyclonal to SLC22A13 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC22A13 aa 500-550 (C terminal).
    Sequence:

    PETHGQGLKDTLQDLELGPHPRSPKSVPSEKETEAKGRTSSPGVAFVSST Y


    Database link: Q9Y226

  • Positive control

    • IHC-P: Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224498 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    This gene encodes a member of the organic cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine.
  • Cellular localization

    Membrane; Multi pass membrane protein.
  • Database links

  • Alternative names

    • OAT10 antibody
    • OCTL 1 antibody
    • OCTL 3 antibody
    • OCTL1 antibody
    • OCTL3 antibody
    • ORCTL 3 antibody
    • ORCTL3 antibody
    • Organic cation transporter like 3 antibody
    • Organic cationic transporter like 3 antibody
    • Solute carrier family 22 (organic cation transporter) member 13 antibody
    • Solute carrier family 22 member 13 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for SLC22A13 using ab224498 at 1/50 dilution in immunohistochemical analysis.

References

ab224498 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224498.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up