Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC22A14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cat
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 144-194 (

    IIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAG

    ) of Human SLC22A14 (NP_004794)

  • Positive control

    • MCF7 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab84063 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    SLC22A14 is a member of the organic-cation transporter family. SLC22A14 is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems. This gene encodes a member of the organic-cation transporter family.
  • Cellular localization

    Membrane; Multi-pass membrane protein
  • Database links

  • Alternative names

    • MGC163415 antibody
    • OCTL2 antibody
    • OCTL4 antibody
    • ORCTL 4 antibody
    • ORCTL4 antibody
    • Organic cation transporter like 4 antibody
    • Organic cationic transporter like 4 antibody
    • SLC22A14 antibody
    • Solute carrier family 22 member 14 antibody
    see all

Images

  • Anti-SLC22A14 antibody (ab84063) at 1 µg/ml (in 5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 67 kDa
    Observed band size: 64 kDa
    why is the actual band size different from the predicted?



    Gel concentration 12%

References

ab84063 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab84063.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up