Overview

  • Product name

    Anti-SLC22A14 antibody - N-terminal
    See all SLC22A14 primary antibodies
  • Description

    Rabbit polyclonal to SLC22A14 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Pig
  • Immunogen

    Synthetic peptide within Human SLC22A14 aa 113-162 (N terminal). The exact sequence is proprietary. (NP_004794).
    Sequence:

    AEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYP


    Database link: Q9Y267

  • Positive control

    • Jurkat whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab179645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa.

Target

  • Relevance

    SLC22A14 is a member of the organic-cation transporter family. SLC22A14 is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems. This gene encodes a member of the organic-cation transporter family.
  • Cellular localization

    Membrane; Multi-pass membrane protein
  • Database links

  • Alternative names

    • MGC163415 antibody
    • OCTL2 antibody
    • OCTL4 antibody
    • ORCTL 4 antibody
    • ORCTL4 antibody
    • Organic cation transporter like 4 antibody
    • Organic cationic transporter like 4 antibody
    • SLC22A14 antibody
    • Solute carrier family 22 member 14 antibody
    see all

Images

  • Anti-SLC22A14 antibody - N-terminal (ab179645) at 1 µg/ml + Jurkat whole cell lysate at 10 µg

    Predicted band size: 67 kDa

References

ab179645 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179645.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up