Overview

  • Product name

    Anti-SLC22A25 antibody
  • Description

    Rabbit polyclonal to SLC22A25
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC22A25 aa 31-145 (extracellular).
    Sequence:

    VYHQTQLENFAAFILDHRCWVHILDNDTIPDNDPGTLSQDALLRISIPFD SNLRPEKCRRFVHPQWKLIHLNGTFPNTSEPDTEPCVDGWVYDQSSFPST IVTKWDLVCESQPLN


    Database link: Q6T423

  • Positive control

    • IHC-P: Human liver cancer tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/50 - 1/200.

Target

  • Tissue specificity

    Expressed exclusively in liver in both embryo and adult.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Organic cation transporter family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • HIMTP antibody
    • MGC120420 antibody
    • Organic anion transporter UST6 antibody
    • S22AP_HUMAN antibody
    • SLC22A25 antibody
    • Solute carrier family 22 member 25 antibody
    • UST6 antibody
    see all

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for SLC22A25 using ab237024 at 1/100 dilution in ICC/IF.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.

  • Paraffin-embedded human liver cancer tissue stained for SLC22A25 with ab237024 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab237024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up