Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC22A4/ETT
  • Host species

    Rabbit
  • Specificity

    ab200641 detects endogenous levels of SLC22A4/ETT.

  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human SLC22A4/ETT aa 275-320. The exact sequence is proprietary.
    Sequence:

    WFIPESPRWLISQRRFREAEDIIQKAAKMNNIAVPAVIFDSVEELN


    Database link: Q9H015

  • Positive control

    • MCF7, mouse sp2/0 and rat PC12 cell lysates.
  • General notes

     This product was previously labelled as SLC22A4

     

Properties

Applications

Our Abpromise guarantee covers the use of ab200641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 62 kDa.

Target

  • Function

    Sodium-ion dependent, low affinity carnitine transporter. Probably transports one sodium ion with one molecule of carnitine. Also transports organic cations such as tetraethylammonium (TEA) without the involvement of sodium. Relative uptake activity ratio of carnitine to TEA is 1.78. A key substrate of this transporter seems to be ergothioneine (ET).
  • Tissue specificity

    Widely expressed. Highly expressed in whole blood, bone marrow, trachea and fetal liver. Weakly expressed in kidney, skeletal muscle, prostate, lung, pancreas, placenta, heart, uterus, spleen and spinal cord. Highly expressed in intestinal cell types affected by Crohn disease, including epithelial cells. Expressed in CD68 macrophage and CD43 T-cells but not in CD20 B-cells. Predominantly expressed in CD14 cells in peripheral blood mononuclear cells.
  • Involvement in disease

    Genetic variations in SLC22A4 are a cause of susceptibility to rheumatoid arthritis (RA) [MIM:180300]. It is a systemic inflammatory disease with autoimmune features and a complex genetic component. It primarily affects the joints and is characterized by inflammatory changes in the synovial membranes and articular structures, widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues, and by atrophy and rarefaction of bony structures.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Organic cation transporter family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ergothioneine transporter antibody
    • ET transporter antibody
    • integral membrane transport protein antibody
    • LSTP Like 2 antibody
    • MGC34546 antibody
    • MGC40524 antibody
    • Octn1 antibody
    • Organic cation transporter 1 antibody
    • Organic cation/carnitine transporter 1 antibody
    • RP23-354D12.1 antibody
    • S22A4_HUMAN antibody
    • Slc22a4 antibody
    • Solute carrier family (organic cation transporter), member 4 antibody
    • solute carrier family 22 (organic cation/zwitterion transporter), member 4 antibody
    • Solute carrier family 22 member 4 antibody
    see all

Images

  • All lanes : Anti-SLC22A4/ETT antibody (ab200641)

    Lane 1 : MCF7 whole cell lysate
    Lane 2 : mouse sp2/0 whole cell lysate
    Lane 3 : rat PC12 whole cell lysate

    Predicted band size: 62 kDa

References

ab200641 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up