Overview

  • Product name

    Anti-SLC22A7/OAT2 antibody
    See all SLC22A7/OAT2 primary antibodies
  • Description

    Rabbit polyclonal to SLC22A7/OAT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Horse, Guinea pig, Cow, Cat, Pig
  • Immunogen

    Synthetic peptide corresponding to Human SLC22A7/OAT2 aa 37-86.
    Sequence:

    LPIFLAAVPAHRCALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYP

  • Positive control

    • Jurkat cell membrane lysate; Human muscle tissue
  • General notes

     This product was previously labelled as SLC22A7

     

Properties

Applications

Our Abpromise guarantee covers the use of ab58683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 5 µg/ml. Detects a band of approximately 60 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function

    Mediates sodium-independent multispecific organic anion transport. Transport of prostaglandin E2, prostaglandin F2, tetracycline, bumetanide, estrone sulfate, glutarate, dehydroepiandrosterone sulfate, allopurinol, 5-fluorouracil, paclitaxel, L-ascorbic acid, salicylate, ethotrexate, and alpha-ketoglutarate.
  • Tissue specificity

    Expressed in liver and kidney.
  • Sequence similarities

    Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family.
  • Cellular localization

    Basolateral cell membrane. Apical side of the renal tubule.
  • Information by UniProt
  • Database links

  • Alternative names

    • hOAT2 antibody
    • liver specific transporter antibody
    • NLT antibody
    • Novel liver transporter antibody
    • OAT2 antibody
    • Organic anion transporter 2 antibody
    • Organic anion transporter member 7 antibody
    • Organic anion transporter member 7 Fragment antibody
    • S22A7_HUMAN antibody
    • SLC22A7 antibody
    • solute carrier family 22 (organic anion transporter) member 7 antibody
    • Solute carrier family 22 antibody
    • Solute carrier family 22 member 7 antibody
    see all

Images

  • All lanes : Anti-SLC22A7/OAT2 antibody (ab58683) at 5 µg/ml

    Lane 1 : Molecular weight marker
    Lane 2 : Jurkat cell lysate at 10 µg

    Secondary
    All lanes : HRP conjugated anti-Rabbit IgG at 1/5000 dilution

    Observed band size: 58 kDa
    why is the actual band size different from the predicted?



    Gel concentration: 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human muscle tissue labelling SLC22A7/OAT2 with ab58683 at 8µg/ml. Arrows indicate positive labelled skeletal muscle cells. Magnification: X400.

  • All lanes : Anti-SLC22A7/OAT2 antibody (ab58683) at 2.5 µg/ml

    Lane 1 : Jurkat cell lysate
    Lane 2 : Jurkat cell lysate with blocking peptide at 2 µg/ml

    Lysates/proteins at 25 µg per lane.

References

ab58683 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab58683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up