Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC23A2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SLC23A2 aa 1-90.
    Sequence:

    MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQD NEDTELMAIYTTENGIAEKSSLAETLDSTGSLDPQRSDMI


    Database link: Q9UGH3

  • Positive control

    • WB: SH-SY5Y and A-375 whole cell lysates. IHC-P: Human tonsil and rectum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab229802 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 70 kDa (predicted molecular weight: 70 kDa).

Target

  • Relevance

    Sodium/ascorbate cotransporter. Mediates electrogenic uptake of vitamin C, with a stoichiometry of 2 Na(+) for each ascorbate.
  • Cellular localization

    Membrane; multi-pass membrane protein.
  • Database links

  • Alternative names

    • KIAA0238 antibody
    • Na(+)/L ascorbic acid transporter 2 antibody
    • NBTL1 antibody
    • RP1 237C24.1 antibody
    • Sodium dependent vitamin C transporter 2 antibody
    • Sodium dependent vitamin C transporter 2 variant II antibody
    • Solute carrier family 23 (nucleobase transporters) member 2 antibody
    • SVCT2 antibody
    • Yolk sac permease like molecule 2 antibody
    • YSPL2 antibody
    see all

Images

  • All lanes : Anti-SLC23A2 antibody (ab229802) at 1/1000 dilution

    Lane 1 : SH-SY5Y (human neuroblastoma cell line from bone marrow) whole cell lysate
    Lane 2 : A-375 (human malignant melanoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 70 kDa
    Observed band size: 70 kDa

  • Paraffin-embedded human tonsil tissue stained for SLC23A2 using ab229802 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human rectum tissue stained for SLC23A2 using ab229802 at 1/100 dilution in immunohistochemical analysis.

References

ab229802 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229802.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up