Anti-SLC23A2 antibody (ab229802)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SLC23A2 antibody
See all SLC23A2 primary antibodies -
Description
Rabbit polyclonal to SLC23A2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human SLC23A2 aa 1-90.
Sequence:MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQD NEDTELMAIYTTENGIAEKSSLAETLDSTGSLDPQRSDMI
Database link: Q9UGH3 -
Positive control
- WB: SH-SY5Y and A-375 whole cell lysates. IHC-P: Human tonsil and rectum tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab229802 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
WB | 1/1000 - 1/5000. Detects a band of approximately 70 kDa (predicted molecular weight: 70 kDa). |
Target
-
Relevance
Sodium/ascorbate cotransporter. Mediates electrogenic uptake of vitamin C, with a stoichiometry of 2 Na(+) for each ascorbate. -
Cellular localization
Membrane; multi-pass membrane protein. -
Database links
- Entrez Gene: 9962 Human
- Entrez Gene: 54338 Mouse
- Entrez Gene: 50622 Rat
- Omim: 603791 Human
- SwissProt: Q9UGH3 Human
- SwissProt: Q9EPR4 Mouse
- SwissProt: Q9WTW8 Rat
- Unigene: 516866 Human
see all -
Alternative names
- KIAA0238 antibody
- Na(+)/L ascorbic acid transporter 2 antibody
- NBTL1 antibody
see all
Images
-
All lanes : Anti-SLC23A2 antibody (ab229802) at 1/1000 dilution
Lane 1 : SH-SY5Y (human neuroblastoma cell line from bone marrow) whole cell lysate
Lane 2 : A-375 (human malignant melanoma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
Predicted band size: 70 kDa
Observed band size: 70 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC23A2 antibody (ab229802)
Paraffin-embedded human tonsil tissue stained for SLC23A2 using ab229802 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC23A2 antibody (ab229802)
Paraffin-embedded human rectum tissue stained for SLC23A2 using ab229802 at 1/100 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab229802 has not yet been referenced specifically in any publications.