Anti-SLC23A2 antibody (ab229802)
Key features and details
- Rabbit polyclonal to SLC23A2
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SLC23A2 antibody -
Description
Rabbit polyclonal to SLC23A2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human SLC23A2 aa 1-90.
Sequence:MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQD NEDTELMAIYTTENGIAEKSSLAETLDSTGSLDPQRSDMI
Database link: Q9UGH3 -
Positive control
- WB: SH-SY5Y and A-375 whole cell lysates. IHC-P: Human tonsil and rectum tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab229802 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. | |
| WB | 1/1000 - 1/5000. Detects a band of approximately 70 kDa (predicted molecular weight: 70 kDa). |
Target
-
Relevance
Sodium/ascorbate cotransporter. Mediates electrogenic uptake of vitamin C, with a stoichiometry of 2 Na(+) for each ascorbate. -
Cellular localization
Membrane; multi-pass membrane protein. -
Database links
- Entrez Gene: 9962 Human
- Entrez Gene: 54338 Mouse
- Entrez Gene: 50622 Rat
- Omim: 603791 Human
- SwissProt: Q9UGH3 Human
- SwissProt: Q9EPR4 Mouse
- SwissProt: Q9WTW8 Rat
- Unigene: 516866 Human
see all -
Alternative names
- KIAA0238 antibody
- Na(+)/L ascorbic acid transporter 2 antibody
- NBTL1 antibody
see all
Images
-
Western blot - Anti-SLC23A2 antibody (ab229802)All lanes : Anti-SLC23A2 antibody (ab229802) at 1/1000 dilution
Lane 1 : SH-SY5Y (human neuroblastoma cell line from bone marrow) whole cell lysate
Lane 2 : A-375 (human malignant melanoma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
Predicted band size: 70 kDa
Observed band size: 70 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC23A2 antibody (ab229802)Paraffin-embedded human tonsil tissue stained for SLC23A2 using ab229802 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC23A2 antibody (ab229802)Paraffin-embedded human rectum tissue stained for SLC23A2 using ab229802 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (1)
ab229802 has been referenced in 1 publication.
- Yang Y et al. SVCT2 Promotes Neural Stem/Progenitor Cells Migration Through Activating CDC42 After Ischemic Stroke. Front Cell Neurosci 13:429 (2019). PubMed: 31607868
