Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC24A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC24A1 aa 55-143.
    Sequence:

    SSHQPIKLASRDLSSEEMMMMSSSPSKPSSEMGGKMLVPQASVGSDEATL SMTVENIPSMPKRTAKMIPTTTKNNYSPTAAGTERRKED


    Database link: O60721

  • Positive control

    • IHC-P: Human retina tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab243573 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Critical component of the visual transduction cascade, controlling the calcium concentration of outer segments during light and darkness. Light causes a rapid lowering of cytosolic free calcium in the outer segment of both retinal rod and cone photoreceptors and the light-induced lowering of calcium is caused by extrusion via this protein which plays a key role in the process of light adaptation. Transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+).
  • Tissue specificity

    Expressed in the retina, particularly in the inner segment, outer and inner nuclear layers, and ganglion cell layer.
  • Involvement in disease

    Defects in SLC24A1 are the cause of congenital stationary night blindness type 1D (CSNB1D) [MIM:613830]. An autosomal recessive form of congenital stationary night blindness a non-progressive retinal disorder characterized by impaired night vision. CSNB1D is characterized by a Riggs type of electroretinogram (proportionally reduced a- and b-waves). Patients have visual acuity within the normal range and no symptoms of myopia and/or nystagmus.
  • Sequence similarities

    Belongs to the sodium/potassium/calcium exchanger family. SLC24A subfamily.
  • Post-translational
    modifications

    The uncleaved signal sequence is required for efficient membrane targeting and proper membrane integration.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CSNB1D antibody
    • HsT17412 antibody
    • KIAA0702 antibody
    • Na(+)/K(+)/Ca(2+) exchange protein 1 antibody
    • Na(+)/K(+)/Ca(2+)-exchange protein 1 antibody
    • NCKX antibody
    • NCKX1 antibody
    • NCKX1_HUMAN antibody
    • Retinal rod Na Ca+K exchanger antibody
    • Retinal rod Na+/Ca+/K+ exchanger antibody
    • Retinal rod Na-Ca+K exchanger antibody
    • RODX antibody
    • Slc24a1 antibody
    • Sodium/potassium/calcium exchanger 1 antibody
    • Solute carrier family 24 (sodium/potassium/calcium exchanger) member 1 antibody
    • Solute carrier family 24 member 1 antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells labeling SLC24A1 using ab243573 at 4 µg/ml (green) in ICC/IF. Nuclear probe is visualized in blue.

  • Formalin-fixed, paraffin-embedded human retina tissue stained for SLC24A1 with ab243573 at 1/1000 dilution in immunohistochemical analysis.

References

ab243573 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243573.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up