Anti-SLC25A11 antibody (ab155196)
Key features and details
- Rabbit polyclonal to SLC25A11
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SLC25A11 antibody
See all SLC25A11 primary antibodies -
Description
Rabbit polyclonal to SLC25A11 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Zebrafish, Xenopus tropicalis
-
Immunogen
Recombinant fragment corresponding to Human SLC25A11 aa 92-314.
Sequence:ATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAE VALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARA VVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVD IAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLPH TVLTFIFLEQMNKAYKRLFLSG
-
Positive control
- Jurkat, Raji whole cell lysate; U87 xenograft
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 79.99% PBS, 20% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab155196 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000 - 1/10000. Predicted molecular weight: 34 kDa. | |
| IHC-P | 1/100 - 1/1000. |
Target
-
Function
Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism. -
Sequence similarities
Belongs to the mitochondrial carrier family.
Contains 3 Solcar repeats. -
Cellular localization
Mitochondrion inner membrane. - Information by UniProt
-
Database links
- Entrez Gene: 282523 Cow
- Entrez Gene: 8402 Human
- Entrez Gene: 67863 Mouse
- Entrez Gene: 64201 Rat
- Entrez Gene: 779410 Xenopus laevis
- Entrez Gene: 595075 Xenopus tropicalis
- Entrez Gene: 415189 Zebrafish
- Omim: 604165 Human
see all -
Alternative names
- M2OM_HUMAN antibody
- Mitochondrial 2 oxoglutarate/malate carrier protein antibody
- Mitochondrial 2-oxoglutarate/malate carrier protein antibody
see all
Images
-
Western blot - Anti-SLC25A11 antibody (ab155196)All lanes : Anti-SLC25A11 antibody (ab155196) at 1/5000 dilution
Lane 1 : Jurkat whole cell lysate
Lane 2 : Raji whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 34 kDa
12% SDS PAGE -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC25A11 antibody (ab155196)Immunohistochemical analysis of paraffin-embedded U87 xenograft tissue labeling SLC25A11 with ab155196 at 1/500 dilution.
Protocols
References (1)
ab155196 has been referenced in 1 publication.
- Lee JS et al. Loss of SLC25A11 causes suppression of NSCLC and melanoma tumor formation. EBioMedicine 40:184-197 (2019). PubMed: 30686754
