Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC25A11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human SLC25A11 aa 2-51 (N terminal).
    Sequence:

    AATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQL

  • Positive control

    • 721_B cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab80464 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-SLC25A11 antibody (ab80464) at 1 µg/ml + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 34 kDa
    Observed band size: 34 kDa

References

This product has been referenced in:

  • Kamga CK  et al. Dicarboxylate carrier-mediated glutathione transport is essential for reactive oxygen species homeostasis and normal respiration in rat brain mitochondria. Am J Physiol Cell Physiol 299:C497-505 (2010). WB ; Mouse . Read more (PubMed: 20538765) »
See 1 Publication for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

According to our records, ab80464 was proving difficult to use in WB and we were in contact in order to help resolve the issue.

Looking at our correspondence, it appears that we are awaiting more details in order to help us better understand the difficulties experienced. If the requested information has already been sent, it appears that it did not reach our Scientific Support team and we apologize for this inconvenience. In this case we would like to ask for the information again so that we can reach a resolution.

If the issue has already been settled, please let us know so that we can be assured that the problem has been solved to your satisfaction and update our records.

We wish you the best of luck with your research and look forward to a reply.

Read More

Answer

Thank you for contacting Abcam regarding ab80464.


I am sorry that you have been experiencing difficulties with this antibody in WB on mouse samples. In order to better understand the problem you are having, can you please provide a detailed summary of your protocol and sample preparation? Also, please provide an order number.


This product is guaranteed for WB in mouse per our Abpromise. I am happy to offer a replacement or credit if the product is not working as stated on the datasheet, within 6 months of purchase.


I look forward to your reply so that I may assist you further. Please do not hesitate to contact me if you have any additional questions.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up