Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC25A17
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human SLC25A17 aa 226-268.
    Sequence:

    VQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYK


    Database link: O43808

  • Positive control

    • U-2 OS cells

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220964 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Peroxisomal transporter for multiple cofactors like coenzyme A (CoA), flavin adenine dinucleotide (FAD), flavin mononucleotide (FMN) and nucleotide adenosine monophosphate (AMP), and to a lesser extend for nicotinamide adenine dinucleotide (NAD(+)), adenosine diphosphate (ADP) and adenosine 3',5'-diphosphate (PAP). May catalyze the transport of free CoA, FAD and NAD(+) from the cytosol into the peroxisomal matrix by a counter-exchange mechanism. Inhibited by pyridoxal 5'-phosphate and bathophenanthroline in vitro.
  • Tissue specificity

    Ubiquitous. Expressed in liver.
  • Sequence similarities

    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Domain

    The N- and C-terminal portions are exposed to the cytoplasm. Lacks a typical peroxisomal sorting signal. A region between helical transmembrane domains (TM) 4 and 5 and TM1-TM3 or TM4-TM6 are necessary for the peroxisome-targeting activity.
  • Cellular localization

    Cytoplasm. Peroxisome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 34 kDa peroxisomal membrane protein antibody
    • peroxisomal membrane protein (34kD) antibody
    • Peroxisomal membrane protein PMP34 antibody
    • PM34_HUMAN antibody
    • PMP34 antibody
    • Slc25a17 antibody
    • solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17 antibody
    • Solute carrier family 25 member 17 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling SLC25A17 with ab220964 at 4 µg/ml.  Antibody staining is shown in green.  

References

ab220964 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up