Overview

  • Product name

    Anti-SLC25A19 antibody - C-terminal
  • Description

    Rabbit polyclonal to SLC25A19 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human SLC25A19 aa 244-274 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). NP_068380.3.
    Sequence:

    LQVGGFEHARAAFGQVRRYKGLMDCAKQVLQ


    Database link: Q9HC21

  • Positive control

    • Human small intestine tissue; Mouse cerebellum and heart tissue lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab190228 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 36 kDa.
IHC-P 1/100.

Target

  • Relevance

    SLC25A19 is a mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria.
  • Cellular localization

    Mitochondrion inner membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • DNC antibody
    • MCPHA antibody
    • Mitochondrial thiamine pyrophosphate carrier antibody
    • Mitochondrial uncoupling protein 1 antibody
    • MUP1 antibody
    • Solute carrier family 25 (mitochondrial deoxynucleotide carrier) member 19 antibody
    • Solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier) member 19 antibody
    • Solute carrier family 25 member 19 antibody
    • TPC antibody
    see all

Images

  • All lanes : Anti-SLC25A19 antibody - C-terminal (ab190228) at 1/1000 dilution

    Lane 1 : Mouse cerebellum tissue lysate
    Lane 2 : Mouse heart tissue lysate

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 36 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human small intestine tissue labeling SLC25A19 with ab190228 at 1/100 dilution.

References

ab190228 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190228.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up