Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC25A20
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human SLC25A20 aa 33-73.
    Sequence:

    TVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYR


    Database link: O43772

  • Positive control

    • IHC-P: Human small intestine tissue. WB: SLC25A20 overexpression HEK-293T lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 33 kDa.

Target

  • Relevance

    SLC25A20 is one of several closely related mitochondrial membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. It mediates the transport of acylcarnitines into the mitochondrial matrix for their oxidation by the mitochondrial fatty acid oxidation pathway. Mutations in this gene are associated with carnitine acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants.
  • Cellular localization

    Mitochondrion inner membrane; Multipass membrane protein.
  • Database links

  • Alternative names

    • CAC antibody
    • CACT antibody
    • Carnitine/acylcarnitine translocase antibody
    • MCAT_HUMAN antibody
    • Mitochondrial carnitine/acylcarnitine carrier protein antibody
    • Solute carrier family 25 (carnitine/acylcarnitine translocase) member 20 antibody
    • Solute carrier family 25 member 20 antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for SLC25A20 using ab224388 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-SLC25A20 antibody (ab224388) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
    Lane 2 : SLC25A20 overexpression HEK-293T lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Predicted band size: 33 kDa

References

ab224388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up