Overview

  • Product name

    Anti-SLC25A35 antibody
  • Description

    Rabbit polyclonal to SLC25A35
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Human SLC25A35 aa 133-182 (internal sequence). The exact sequence is proprietary.
    Sequence:

    QAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSST


    Database link: Q3KQZ1

  • Positive control

    • Human stomach tumor lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab194014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa.

Target

Images

  • Anti-SLC25A35 antibody (ab194014) at 1 µg/ml + Human stomach tumor lysate at 10 µg

    Predicted band size: 32 kDa

References

ab194014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Mouse Tissue lysate - whole (heart)
Gel Running Conditions
Reduced Denaturing (10)
Loading amount
20 µg
Specification
heart
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Dec 05 2018

Application
Western blot
Sample
Mouse Cell lysate - whole cell (NSC34)
Gel Running Conditions
Reduced Denaturing (12% gel)
Loading amount
20 µg
Specification
NSC34
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jul 19 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up