Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC25A36
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human SLC25A36 aa 37-118.
    Sequence:

    SSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLGP NLVGVAPSRAIYFAAYSNCKEKLNDVFDPDST


    Database link: Q96CQ1

  • Positive control

    • IHC-P: Human pancreas tissue. WB: SLC25A36 overexpression HEK-293T cell lysate. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 34 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Paraffin-embedded human pancreas tissue stained for SLC25A36 using ab224750 at 1/20 dilution in immunohistochemical analysis.

  • All lanes : Anti-SLC25A36 antibody (ab224750) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : SLC25A36 overexpression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Developed using the ECL technique.

    Predicted band size: 34 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for SLC25A36 (green) using ab224750 at 4 µg/ml in ICC/IF.

References

ab224750 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Salivary gland)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: CS 6.0
Permeabilization
No
Specification
Salivary gland
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Dec 04 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up