Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC25A39
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human SLC25A39 aa 38-115. The immunogen corresponds to isoform 2 of SLC25A39.
    Sequence:

    RLQSQRPSMASELMPSSRLWSLSYTKWKCLLYCNGVLEPLYLCPNGARCA TWFQDPTRFTGTMDAFVKIVRHEGTRTL


    Database link: Q9BZJ4-2

  • Positive control

    • IHC-P: Human tonsil tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224471 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Paraffin-embedded human tonsil tissue stained for SLC25A39 using ab224471 at 1/50 dilution in immunohistochemical analysis.

References

ab224471 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224471.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up