Overview

  • Product name

    Anti-SLC25A46/TB1 antibody
    See all SLC25A46/TB1 primary antibodies
  • Description

    Rabbit polyclonal to SLC25A46/TB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SLC25A46/TB1 aa 290-362.
    Sequence:

    LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH RLHIQGTRTIIDNTDLGYEVLPI


    Database link: Q96AG3

  • Positive control

    • IHC-P: Human colon tissue. WB: RT4 cell lysate.
  • General notes

     This product was previously labelled as SLC25A46

     

Properties

Applications

Our Abpromise guarantee covers the use of ab222197 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 46 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Paraffin-embedded human colon tissue stained for SLC25A46/TB1 using ab222197 at a 1/50 dilution in immunohistochemical analysis.

  • Anti-SLC25A46/TB1 antibody (ab222197) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 46 kDa

References

ab222197 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222197.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up