Overview

  • Product name

    Anti-SLC26A2/DTD antibody - N-terminal
    See all SLC26A2/DTD primary antibodies
  • Description

    Rabbit polyclonal to SLC26A2/DTD - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human SLC26A2/DTD aa 1-50 (N terminal). The exact sequence is proprietary. (NP_000103.2).
    Sequence:

    MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRP


    Database link: P50443

  • Positive control

    • HeLa and 293T whole cell lysates.
  • General notes

     This product was previously labelled as SLC26A2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab191158 was affinity purified using an epitope specific to SLC26A2/DTD immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 82 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Relevance

    SLC26A2, or diastrophic dysplasia sulfate transporter, is a glycoprotein implicated in the pathogenesis of several forms of chondrodysplasia. This gene is implicated in sulfation of proteoglycans and matrix organization in the cartilage and may play a role in endochondral bone formation. Sulfate transporter.
  • Cellular localization

    Membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • D5S1708 antibody
    • Diastrophic dysplasia protein antibody
    • Diastrophic dysplasia sulfate transporter antibody
    • DTD antibody
    • DTDST antibody
    • EDM 4 antibody
    • EDM4 antibody
    • MST 153 antibody
    • MST153 antibody
    • MSTP 157 antibody
    • MSTP157 antibody
    • Solute carrier family 26 (anion exchanger) member 2 antibody
    • Solute carrier family 26 (sulfate transporter) member 2 antibody
    • Solute carrier family 26 member 2 antibody
    • Sulfate anion transporter 1 antibody
    • Sulfate transporter antibody
    see all

Images

  • All lanes : Anti-SLC26A2/DTD antibody - N-terminal (ab191158) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 82 kDa


    Exposure time: 3 minutes


    Lysates prepared using RIPA lysis buffer.

  • Detection of SLC26A2/DTD in Immunoprecipitates of HeLa whole cell lysate prepared using RIPA lysis buffer (1 mg for IP, 20% of IP loaded), using ab191158 at 6 µg/mg lysate for IP and at 1 µg/ml for subsequent Western blot detection.
    Detection: Chemiluminescence with an exposure time of 3 minutes.

References

ab191158 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up