Anti-SLC26A3 antibody (ab244452)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SLC26A3 antibody
See all SLC26A3 primary antibodies -
Description
Rabbit polyclonal to SLC26A3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SLC26A3 aa 617-733.
Sequence:DQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDVSSVRG LKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSSIFFLTIHDA VLHILMKKDYSTSKFNP
Database link: P40879 -
Positive control
- IHC-P: Human colon and small intestine tissues. WB: SLC26A3 over-expression HEK-293T lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa).
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab244452 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.4 µg/ml. Predicted molecular weight: 85 kDa. | |
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Chloride/bicarbonate exchanger. Involved in absorbtion of in the colon. Helps mediate electrolyte and fluid absorption. -
Involvement in disease
Defects in SLC26A3 are the cause of diarrhea type 1 (DIAR1) [MIM:214700]; also known as congenital chloride diarrhea (CLD). DIAR1 is a disease characterized by voluminous watery stools containing an excess of chloride. The children with this disease are often premature. -
Sequence similarities
Belongs to the SLC26A/SulP transporter (TC 2.A.53) family.
Contains 1 STAS domain. -
Developmental stage
Expression is significantly decreased in adenomas (polyps) and adenocarcinomas of the colon. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 1811 Human
- Omim: 126650 Human
- SwissProt: P40879 Human
- Unigene: 1650 Human
-
Alternative names
- Chloride anion exchanger antibody
- CLD antibody
- Congenital chloride diarrhea antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC26A3 antibody (ab244452)Paraffin-embedded human colon tissue stained for SLC26A3 using ab244452 at 1/200 dilution in immunohistochemical analysis. -
Western blot - Anti-SLC26A3 antibody (ab244452)All lanes : Anti-SLC26A3 antibody (ab244452) at 0.4 µg/ml
Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
Lane 2 : SLC26A3 over-expression HEK-293T lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa)
Predicted band size: 85 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC26A3 antibody (ab244452)Paraffin-embedded human small intestine tissue stained for SLC26A3 using ab244452 at 1/200 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC26A3 antibody (ab244452)Paraffin-embedded human skeletal muscle tissue stained for SLC26A3 using ab244452 at 1/200 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab244452 has not yet been referenced specifically in any publications.
