Overview

  • Product name

    Anti-SLC27A4 / FATP4 antibody
    See all SLC27A4 / FATP4 primary antibodies
  • Description

    Rabbit polyclonal to SLC27A4 / FATP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SLC27A4/ FATP4 aa 494-643.
    Sequence:

    DELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPG TEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGT YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL


    Database link: Q6P1M0

  • Positive control

    • IHC-P: Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    SLC27A4 / FATP4 plays a role in the transport of long chain fatty acids across the plasma membrane. It has acyl-coA ligase activity for long chain and very long chain fatty acids. Deletion of the SLC27A4 gene results in embryonic lethality, which is attributed to the need for fat absorption across the visceral endoderm early in embryonic development. Expression of FAT4P in the intestinal lining is thought to be altered in response to dietary fat.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • ACSVL 4 antibody
    • ACSVL4 antibody
    • EC 6.2.1 antibody
    • FATP 4 antibody
    • FATP4 antibody
    • Fatty acid transport protein 4 antibody
    • Fatty acid transport protein4 antibody
    • IPS antibody
    • Long chain fatty acid transport protein 4 antibody
    • Long chain fatty acid transport protein4 antibody
    • OTTHUMP00000022264 antibody
    • S27A4 antibody
    • SLC27 A4 antibody
    • SLC27A 4 antibody
    • Solute carrier family 27 (fatty acid transporter) member 4 antibody
    • Solute carrier family 27 member 4 antibody
    • Solute carrier family 27 member4 antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for SLC27A4 / FATP4 using ab238712 at 1/100 dilution in immunohistochemical analysis.

References

ab238712 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238712.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up