Overview

  • Product name

    Anti-SLC27A5/BAL antibody [CL0213]
    See all SLC27A5/BAL primary antibodies
  • Description

    Mouse monoclonal [CL0213] to SLC27A5/BAL
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC27A5/BAL aa 223-345.
    Sequence:

    RVLVVDPDLRESLEEILPKLQAENIRCFYLSHTSPTPGVGALGAALDAAP SHPVPADLRAGITWRSPALFIYTSGTTGLPKPAILTHERVLQMSKMLSLS GATADDVVYTVLPLYHVMGLVVG


    Database link: Q9Y2P5

  • Positive control

    • Human liver tissue; Human liver tissue lysate.
  • General notes

    The antibody solution should be gently mixed before use.

    Product previously known as SLC27A5.

Properties

Applications

Our Abpromise guarantee covers the use of ab154140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/1000 - 1/2500. Predicted molecular weight: 75 kDa.

Target

  • Function

    Acyl-CoA synthetase involved in bile acid metabolism. Proposed to catalyze the first step in the conjugation of C24 bile acids (choloneates) to glycine and taurine before excretion into bile canaliculi by activating them to their CoA thioesters. Seems to activate secondary bile acids entering the liver from the enterohepatic circulation. In vitro, also activates 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol.
  • Tissue specificity

    Predominantly expressed in liver.
  • Sequence similarities

    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACSB antibody
    • ACSVL6 antibody
    • BA CoA ligase antibody
    • BA-CoA ligase antibody
    • BACS antibody
    • BAL antibody
    • Bile acid CoA ligase antibody
    • Bile acid-CoA ligase antibody
    • Bile acyl CoA synthetase antibody
    • Bile acyl-CoA synthetase antibody
    • Cholate CoA ligase antibody
    • Cholate--CoA ligase antibody
    • FACVL3 antibody
    • FATP 5 antibody
    • FATP-5 antibody
    • FATP5 antibody
    • Fatty acid Coenzyme A ligase very long chain 3 antibody
    • Fatty acid transport protein 5 antibody
    • Fatty-acid-coenzyme A ligase antibody
    • FLJ22987 antibody
    • S27A5_HUMAN antibody
    • Slc27a5 antibody
    • Solute carrier family 27 (fatty acid transporter) member 5 antibody
    • Solute carrier family 27 member 5 antibody
    • Very long chain acyl CoA synthetase homolog 2 antibody
    • Very long chain acyl CoA synthetase related protein antibody
    • very long-chain 3 antibody
    • Very long-chain acyl-CoA synthetase homolog 2 antibody
    • Very long-chain acyl-CoA synthetase-related protein antibody
    • VLACS related antibody
    • VLACS-related antibody
    • VLACSR antibody
    • VLCS H2 antibody
    • VLCS-H2 antibody
    • VLCSH2 antibody
    see all

Images

  • Immunohistochemical analysis of Human liver tissue labeling SLC27A5/BAL with ab154140 at 1/500 dilution.

  • Immunohistochemical analysis of Human pancreas tissue showing no labeling of SLC27A5/BAL using ab154140 at 1/500 dilution (negative control).

  • Anti-SLC27A5/BAL antibody [CL0213] (ab154140) at 1/1000 dilution + Human liver tissue lysate

    Predicted band size: 75 kDa

References

ab154140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab154140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up