Anti-GLUT-7 antibody (ab122604)
Key features and details
- Rabbit polyclonal to GLUT-7
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GLUT-7 antibody -
Description
Rabbit polyclonal to GLUT-7 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human GLUT-7 aa 43-73.
Sequence:SVVNTPHKVFKSFYNETYFERHATFMDGKLM
-
Positive control
- Human Liver tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store undiluted. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122604 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
IHC-P
1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
High-affinity transporter for glucose and fructose Does not transport galactose, 2-deoxy-d-glucose and xylose. -
Tissue specificity
Expressed in small intestine and colon. Weakly expressed in testis and prostate. -
Sequence similarities
Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 155184 Human
- Omim: 610371 Human
- SwissProt: Q6PXP3 Human
- Unigene: 531239 Human
-
Alternative names
- facilitated glucose transporter member 7 antibody
- Glucose transporter type 7 antibody
- GLUT-7 antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab122604 has not yet been referenced specifically in any publications.