Overview

  • Product name

    Anti-SLC32A1/VGAT antibody
    See all SLC32A1/VGAT primary antibodies
  • Description

    Rabbit polyclonal to SLC32A1/VGAT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Dog, Pig, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to Human SLC32A1/VGAT aa 72-121 (N terminal).
    Sequence:

    DEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWEA


    Database link: NP_542119

  • Positive control

    • PANC1 cell lysate
  • General notes

     This product was previously labelled as SLC32A1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab90148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 58 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-SLC32A1/VGAT antibody (ab90148) at 1 µg/ml (in 5% skim milk / PBS buffer) + PANC1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 58 kDa



    Gel concentration: 12%

References

ab90148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab90148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up