Overview

  • Product name

    Anti-SLC32A1/VGAT antibody [CL2793]
    See all SLC32A1/VGAT primary antibodies
  • Description

    Mouse monoclonal [CL2793] to SLC32A1/VGAT
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human SLC32A1/VGAT aa 13-103.
    Sequence:

    ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDI LKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG


    Database link: Q9H598

  • Positive control

    • Rat basal forebrain, mouse globus pallidus, human substantia nigra pars reticulata, rat globus pallidus, mouse deep cerebellar nucleus, rat substantia nigra and mouse cerebellum tissues.
  • General notes

     This product was previously labelled as SLC32A1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL2793
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab211534 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue labeling SLC32A1/VGAT with ab211534 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded rat substantia nigra tissue labeling SLC32A1/VGAT with ab211534 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded mouse deep cerebellar nucleus tissue labeling SLC32A1/VGAT with ab211534 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded rat globus pallidus tissue labeling SLC32A1/VGAT with ab211534 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded human substantia nigra pars reticulata tissue labeling SLC32A1/VGAT with ab211534 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded mouse globus pallidus tissue labeling SLC32A1/VGAT with ab211534 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded rat basal forebrain tissue labeling SLC32A1/VGAT with ab211534 at 1/50 dilution.

References

ab211534 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211534.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up