Overview

  • Product name

    Anti-SLC35A1 antibody
  • Description

    Rabbit polyclonal to SLC35A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC35A1 aa 1-100.
    Sequence:

    MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCI TEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAV


    Database link: P78382

  • Positive control

    • IHC-P: Human spleen tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Transports CMP-sialic acid from the cytosol into Golgi vesicles where glycosyltransferases function.
  • Involvement in disease

    Defects in SLC35A1 are the cause of congenital disorder of glycosylation type 2F (CDG2F) [MIM:603585]. CDGs are a family of severe inherited diseases caused by a defect in protein N-glycosylation. They are characterized by under-glycosylated serum proteins. These multisystem disorders present with a wide variety of clinical features, such as disorders of the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions.
  • Sequence similarities

    Belongs to the nucleotide-sugar transporter family. SLC35A subfamily.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CMP-SA-Tr antibody
    • CMP-Sia-Tr antibody
    • CMP-sialic acid transporter antibody
    • S35A1_HUMAN antibody
    • Slc35a1 antibody
    • Solute carrier family 35 member A1 antibody
    see all

Images

  • Paraffin-embedded human spleen tissue stained for SLC35A1 using ab230196 at 1/100 dilution in immunohistochemical analysis

References

ab230196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up