Overview

  • Product name

    Anti-SLC35A2 antibody
  • Description

    Rabbit polyclonal to SLC35A2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Dog
  • Immunogen

    Recombinant fragment corresponding to Human SLC35A2 aa 136-234.
    Sequence:

    LPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQ QAGGGGPRPLDQNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLR


    Database link: P78381

  • Positive control

    • WB: Mouse stomach tissue lysate. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/2000 - 1/5000. Detects a band of approximately 42 kDa (predicted molecular weight: 41 kDa).

Target

Images

  • Anti-SLC35A2 antibody (ab222854) at 1/2000 dilution + Mouse stomach tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.

    Predicted band size: 41 kDa
    Observed band size: 42 kDa
    why is the actual band size different from the predicted?

  • PFA-fixed, Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for SLC35A2 (green) using ab222854 at 1/100 dilution in ICC/IF.

References

ab222854 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up