Overview

  • Product name

    Anti-SLC37A1 antibody
  • Description

    Rabbit polyclonal to SLC37A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC37A1 aa 245-302.
    Sequence:

    PNDVRCSSTLVTHSKGYENGTNRLRLQKQILKSEKNKPLDPEMQCLLLSD GKGSIHPN


    Database link: P57057

  • Positive control

    • IHC-P: Human skeletal muscle and colon cancer tissues. ICC/IF: MCF7 cells.
  • General notes

    Previously labelled as glycerol-3-phosphate permease.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab222800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Tissue specificity

    Expressed in numerous tissues, with highest expression in kidney, bone marrow, spleen, liver, small intestine, as well as in fetal brain, liver and spleen.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Organophosphate:Pi antiporter (OPA) (TC 2.A.1.4) family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • G-3-P permease antibody
    • G-3-P transporter antibody
    • G3P permease antibody
    • G3P transporter antibody
    • G3PP antibody
    • GLPT_HUMAN antibody
    • Glycerol-3-phosphate permease antibody
    • Glycerol-3-phosphate transporter antibody
    • SLC37A1 antibody
    • solute carrier family 37 (glycerol-3-phosphate transporter), member 1 antibody
    • Solute carrier family 37 member 1 antibody
    see all

Images

  • MCF7 (human breast adenocarcinoma cell line) cells stained for SLC37A1 (green) using ab222800 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human skeletal muscle tissue stained for SLC37A1 with ab222800 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for SLC37A1 with ab222800 at 1/100 dilution in immunohistochemical analysis.

References

ab222800 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up