Overview

  • Product name

    Anti-SLC38A1/NAT2 antibody
    See all SLC38A1/NAT2 primary antibodies
  • Description

    Rabbit polyclonal to SLC38A1/NAT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human SLC38A1/NAT2 (internal sequence).
    Sequence:

    TAIFGYLTFYDNVQSDLLHKYQSKDDILILTVRLAVIVAVILTVPVLFFT

  • Positive control

    • HepG2 cells. Kidney tissue.
  • General notes

     This product was previously labelled as SLC38A1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab59721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 64 kDa (predicted molecular weight: 58 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function

    Functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of glutamine and sodium ions with a stoichiometry of 1:1. May also transport small zwitterionic and aliphatic amino acids with a lower affinity. May supply glutamatergic and GABAergic neurons with glutamine which is required for the synthesis of the neurotransmitters glutamate and GABA.
  • Tissue specificity

    Expressed in the cerebral cortex by pyramidal and GABAergic neurons, astrocytes and other non-neuronal cells (at protein level). Expressed in placenta, heart, lung, skeletal muscle, spleen, stomach and testis.
  • Sequence similarities

    Belongs to the amino acid/polyamine transporter 2 family.
  • Cellular localization

    Cell membrane. Restricted to the somatodendritic compartment of neurons. Found in the cellular processes of neurons in the developing brain (By similarity).
  • Information by UniProt
  • Database links

  • Alternative names

    • Amino acid transporter A1 antibody
    • Amino acid transporter system A1 antibody
    • ATA 1 antibody
    • ATA1 antibody
    • N-system amino acid transporter 2 antibody
    • NAT 2 antibody
    • NAT2 antibody
    • S38A1_HUMAN antibody
    • SAT 1 antibody
    • SAT1 antibody
    • SLC38A1 antibody
    • SNAT 1 antibody
    • SNAT1 antibody
    • Sodium-coupled neutral amino acid transporter 1 antibody
    • Solute carrier family 38 member 1 antibody
    • System A amino acid transporter 1 antibody
    • System N amino acid transporter 1 antibody
    see all

Images

  • Anti-SLC38A1/NAT2 antibody (ab59721) at 2.5 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 58 kDa
    Observed band size: 64 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling SLC38A1/NAT2 with ab59721 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the renal tubules. Magnification: 400X.

References

This product has been referenced in:

  • Shang M & Wen Z Increased placental IGF-1/mTOR activity in macrosomia born to women with gestational diabetes. Diabetes Res Clin Pract 146:211-219 (2018). Read more (PubMed: 30389621) »
  • Luo M  et al. miR-137 regulates ferroptosis by targeting glutamine transporter SLC1A5 in melanoma. Cell Death Differ 25:1457-1472 (2018). Read more (PubMed: 29348676) »
See all 6 Publications for this product

Customer reviews and Q&As

Application
Western blot
Sample
Rat Tissue lysate - whole (placenta, day 20)
Gel Running Conditions
Reduced Denaturing (5%)
Loading amount
30 µg
Specification
placenta, day 20
Blocking step
PVA as blocking agent for 1 minute(s) · Concentration: 1µg/mL

Dr. Heidi Engelhardt

Verified customer

Submitted Feb 26 2011

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up