Overview

  • Product name

    Anti-SLC38A7 antibody
  • Description

    Rabbit polyclonal to SLC38A7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SLC38A7 aa 1-55.
    Sequence:

    MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGT TSTLG


    Database link: Q9NVC3

  • Positive control

    • IHC-P: Human skin tissue. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab238881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    SLC38A7 is putative sodium-dependent amino acid/proton antiporter.
  • Cellular localization

    Membrane; Multi-pass membrane protein
  • Database links

  • Alternative names

    • Amino acid transporter antibody
    • FLJ10815 antibody
    • FLJ12724 antibody
    • Putative sodium coupled neutral amino acid transporter 7 antibody
    • Solute carrier family 38 member 7 antibody
    see all

Images

  • U-251 MG (human brain glioma cell line) cells stained for SLC38A7 (green) using ab238881 at a 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human skin tissue stained for SLC38A7 with ab238881 at a 1/100 dilution in immunohistochemical analysis.

References

ab238881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up