Overview

  • Product name

    Anti-SLC39A6/ZIP-6 antibody
    See all SLC39A6/ZIP-6 primary antibodies
  • Description

    Rabbit polyclonal to SLC39A6/ZIP-6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human SLC39A6/ZIP-6 aa 301-350.
    Sequence:

    RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN

  • Positive control

    • Jurkat cell lysate and human kidney tissue.
  • General notes

    Previously labelled as SLC39A6. 

Properties

Applications

Our Abpromise guarantee covers the use of ab61307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 48 kDa (predicted molecular weight: 48 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function

    May act as a zinc-influx transporter.
  • Tissue specificity

    Highly expressed in the breast, prostate, placenta, kidney, pituitary and corpus callosum. Weakly expressed in heart and intestine. Also highly expressed in cells derived from an adenocarcinoma of the cervix and lung carcinoma.
  • Sequence similarities

    Belongs to the ZIP transporter (TC 2.A.5) family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Estrogen regulated protein LIV 1 6 antibody
    • Estrogen-regulated protein LIV-1 antibody
    • LIV 1 antibody
    • LIV 1 protein, estrogen regulated antibody
    • S39A6_HUMAN antibody
    • SLC39A6 antibody
    • Solute carrier family 39 (metal ion transporter), member 6 antibody
    • solute carrier family 39 (zinc transporter), member 6 antibody
    • Solute carrier family 39 member 6 antibody
    • Zinc transporter ZIP6 antibody
    • ZIP 6 antibody
    • ZIP-6 antibody
    • Zrt and Irt like protein 6 antibody
    • Zrt- and Irt-like protein 6 antibody
    see all

Images

  • Anti-SLC39A6/ZIP-6 antibody (ab61307) at 1.25 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit Ig at 1/50000 dilution

    Predicted band size: 48 kDa
    Observed band size: 48 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling SLC39A6/ZIP-6 with ab61307 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the renal tubule. Magnification: 400X.

References

This product has been referenced in:

  • Mendiola M  et al. Predictive value of angiogenesis-related gene profiling in patients with HER2-negative metastatic breast cancer treated with bevacizumab and weekly paclitaxel. Oncotarget 7:24217-27 (2016). IHC . Read more (PubMed: 26992213) »
  • Trokovic N  et al. Exosomal secretion of death bullets: a new way of apoptotic escape? Am J Physiol Endocrinol Metab 303:E1015-24 (2012). IHC-P ; Mouse . Read more (PubMed: 22912365) »
See all 2 Publications for this product

Customer reviews and Q&As

Question
Answer

Thank you for your enquiry. The exact protocol used is as below: 1. Deparaffinize sections in 3 changes of xylene, 5 minutes each 2. Hydrate in 2 changes of 100% ethanol for 3 minutes each, 95% and 80% ethanol for 1 minute each. 3. Rinse the sections in distilled water followed by 0.1 M PBS. 4. Quench endogenous peroxidase for 10 min with 3% H2O2 in 0.1 M PBS and wash 3 times with distilled water, 2 minutes each. 5. Retrieve epitopes by incubating the sections at 98-100° C in a microwave in 0.01 M citrate buffer (pH 6.0) for 10 minutes. Cool down in room temperature for 30-60 min. 6. Rinse the sections in 0.1 M PBS for 3 × 2 min. 7. Block the sections with 10% normal goat serum in 0.1 M PBS at room temperature for 30 min. 8. Incubate the sections with primary antibody at appropriate dilution in 0.1 M PBS (2-4µg /ml) overnight at 4 ° C. 9. Rinse the sections in 0.1 M PBS for 3 × 5 min. 10. Incubate the sections with biotinylated goat anti-rabbit IgG (SPN-9001, Vector, 1/200 in 0.1M PBS, 37° C, 20 min) 11. Rinse the sections in 0.1 M PBS for 3 × 5 min. 12. Incubate the sections with HRP-conjugated streptavidin (SPN-9001, Vector, 1/200 in 0.1 M PBS, 37 ° C, 20 min) 13. Rinse the sections with 0.1 M PBS for 3 × 5 min followed by 50 mM Tris-HCl buffer (pH 7.6). 14. Incubate with a peroxidase substrate solution. 15. Rinse the sections in distilled water. 16. Counterstain for 10-30 seconds with a hematoxylin counterstaining solution. 17. Rinse the sections with tap water. 18. Dehydrate through 70-80-90-95-100-100% of ethanols, each 3 minutes. 19. Clear in xylene for 2×3 min. 20. Coverslip with mounting medium.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up