Overview

  • Product name

    Anti-SLC40A1 antibody [C2]
    See all SLC40A1 primary antibodies
  • Description

    Mouse monoclonal [C2] to SLC40A1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SLC40A1 aa 127-321. Two N-terminal Tags, His-tag and GST-tag (Expressed in E.coli).
    Sequence:

    WVLTSCYILIITIANIANLASTATAITIQRDWIVVVAGEDRSKLANMNAT IRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKV YQKTPALAVKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHEL EHEQEPTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTV


    Database link: Q9NP59

  • Positive control

    • WB: Recombinant human SLC40A1 protein; pig skeletal muscle lysate. IHC-P: Human brain, glioma, stomach and rectal cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab239583 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 30 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 63 kDa.

Target

  • Function

    May be involved in iron export from duodenal epithelial cell and also in transfer of iron between maternal and fetal circulation. Mediates iron efflux in the presence of a ferroxidase (hephaestin and/or ceruloplasmin).
  • Tissue specificity

    Expressed in placenta, intestine, muscle and spleen.
  • Involvement in disease

    Defects in SLC40A1 are the cause of hemochromatosis type 4 (HFE4) [MIM:606069]. HFE4 is an autosomal dominant iron-loading disorder characterized by early iron accumulation in reticuloendothelial cells and a marked increase in serum ferritin before elevation of the transferrin saturation.
  • Sequence similarities

    Belongs to the SLC40A transporter family.
  • Cellular localization

    Cell membrane. Localized to the basolateral membrane of polarized epithelial cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ferroportin 1 antibody
    • Ferroportin antibody
    • Ferroportin-1 antibody
    • FPN1 antibody
    • HFE4 antibody
    • IREG1 antibody
    • iron regulated gene 1 antibody
    • Iron regulated transporter 1 antibody
    • Iron-regulated transporter 1 antibody
    • MST079 antibody
    • MSTP079 antibody
    • MTP1 antibody
    • putative ferroportin 1 variant IIIA antibody
    • putative ferroportin 1 variant IIIB antibody
    • S40A1_HUMAN antibody
    • SLC11A3 antibody
    • SLC11A3, formerly antibody
    • SLC40A1 antibody
    • solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3 antibody
    • solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3, formerly antibody
    • solute carrier family 40 (iron-regulated transporter), member 1 antibody
    • Solute carrier family 40 member 1 antibody
    see all

Images

  • Paraffin-embedded human stomach tissue stained for SLC40A1 using ab239583 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-SLC40A1 antibody [C2] (ab239583) at 2 µg/ml + Pig skeletal muscle lysate

    Secondary
    HRP-Linked Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 63 kDa

  • Paraffin-embedded human brain tissue stained for SLC40A1 using ab239583 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for SLC40A1 using ab239583 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human rectal cancer tissue stained for SLC40A1 using ab239583 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-SLC40A1 antibody [C2] (ab239583) at 5 µg/ml + Recombinant human SLC40A1 protein

    Predicted band size: 63 kDa

References

ab239583 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239583.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up