Overview

  • Product name

    Anti-SLC44A1/CTL1 antibody
    See all SLC44A1/CTL1 primary antibodies
  • Description

    Rabbit polyclonal to SLC44A1/CTL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human SLC44A1/CTL1 aa 70-120 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GQKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSV ALCVAACPRQ


    Database link: Q8WWI5

  • Positive control

    • WB - Mouse liver lysate. IHC-P - Rat bone marrow tissue.
  • General notes

     This product was previously labelled as SLC44A1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA

    Aqueous buffered solution
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217626 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 73 kDa.
IHC-P 1/100 - 1/500.

Target

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Rat bone marrow tissue labeling SLC44A1/CTL1 with ab217626 at 1/200 dilution. 

  • Anti-SLC44A1/CTL1 antibody (ab217626) at 1/300 dilution + Mouse liver lysate

    Predicted band size: 73 kDa

References

ab217626 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217626.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up