Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC44A2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SLC44A2 aa 384-439.
    Sequence:

    FLSTSNEAVYKIFDDSPCPFTAKTCNPETFPSSNESRQCPNARCQFAFYG GESGYH


    Database link: Q8IWA5

  • Positive control

    • ICC/IF: HaCaT cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Putative choline transporter.
  • Tissue specificity

    Present in supporting cells of the inner ear (at protein level).
  • Sequence similarities

    Belongs to the CTL (choline transporter-like) family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Choline transporter like protein 2 antibody
    • Choline transporter-like protein 2 antibody
    • CTL 2 antibody
    • CTL2 antibody
    • CTL2_HUMAN antibody
    • DKFZp666A071 antibody
    • FLJ44586 antibody
    • PP1292 antibody
    • SLC44A2 antibody
    • Solute carrier family 44 (choline transporter) member 2 antibody
    • Solute carrier family 44 member 2 antibody
    • Testicular tissue protein Li 47 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HaCaT (human keratinocyte cell line) cells stained for SLC44A2 (green) using ab221759 at 4 µg/ml in ICC/IF.

References

ab221759 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up