Overview

  • Product name

    Anti-SLC4A7/NBCn1 antibody
    See all SLC4A7/NBCn1 primary antibodies
  • Description

    Rabbit polyclonal to SLC4A7/NBCn1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Monkey
  • Immunogen

    Synthetic peptide corresponding to Human SLC4A7/NBCn1 aa 516-555 conjugated to keyhole limpet haemocyanin.
    Sequence:

    EFLDQVTVLPPGEWDPSIRIEPPKSVPSQEKRKIPVFHNG


    Database link: Q9Y6M7

  • Positive control

    • WB: A549, RAW 264.7 and PC-12 whole cell lysates. IHC-P: Human pancreas and kidney tissues.
  • General notes

     This product was previously labelled as SLC4A7

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.01% Sodium azide
    Constituents: PBS, 30% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100.
WB 1/500 - 1/1000. Predicted molecular weight: 136 kDa.

Target

  • Function

    Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na(+):HCO3(-) 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity.
  • Tissue specificity

    Highly expressed in testis and spleen. Also expressed in retina, colon, small intestine, ovary, thymus, prostate, muscle, heart and kidney. Isoform 1 is expressed in skeletal muscle and heart muscle.
  • Sequence similarities

    Belongs to the anion exchanger (TC 2.A.31) family.
  • Domain

    The PDZ-binding motif mediates interaction with the CFTR, SLC9A3R1/EBP50 complex and probably with USH1C.
  • Cellular localization

    Basolateral cell membrane. Apical cell membrane. Cell projection, stereocilium. Also described at the apical cell membrane. Localizes to the stereocilia of cochlear outer hair cells and to the lateral membrane of cochlear inner hair cells (By similarity).
  • Information by UniProt
  • Database links

  • Alternative names

    • Bicarbonate transporter antibody
    • BT antibody
    • Electroneutral Na/HCO(3) cotransporter antibody
    • NBC2 antibody
    • NBC3 antibody
    • S4A7 antibody
    • S4A7_HUMAN antibody
    • SBC2 antibody
    • SLC4A6 antibody
    • Slc4a7 antibody
    • Sodium bicarbonate cotransporter 2 antibody
    • Sodium bicarbonate cotransporter 2b antibody
    • Sodium bicarbonate cotransporter 3 antibody
    • Solute carrier family 4 member 7 antibody
    • Solute carrier family 4 sodium bicarbonate cotransporter member 7 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for SLC4A7/NBCn1 using ab230848 at 1/100 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for SLC4A7/NBCn1 using ab230848 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-SLC4A7/NBCn1 antibody (ab230848) at 1/500 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : RAW 264.7 (mouse macrophage cell line transformed with Abelson murine leukemia virus) whole cell lysate
    Lane 3 : PC-12 (rat adrenal gland pheochromocytoma cell line) whole cell lysate

    Developed using the ECL technique.

    Predicted band size: 136 kDa

References

ab230848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up