Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC51B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC51B aa 77-127.
    Sequence:

    VLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPET E

  • Positive control

    • Human colon tissue.
  • General notes

     This product was previously labelled as OST-beta

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab121285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids.
  • Tissue specificity

    Widely expressed with a high expression in ileum. Expressed in testis, colon, liver, small intestine, kidney, ovary and adrenal gland; and at low levels in heart, lung, brain, pituitary, thyroid gland, uterus, prostate, mammary gland and fat.
  • Sequence similarities

    Belongs to the OST-beta family.
  • Cellular localization

    Cell membrane. Mainly restricted to the lateral and basal membranes of ileal enterocytes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Organic solute transporter subunit beta antibody
    • OST-beta antibody
    • OSTB antibody
    • OSTB_HUMAN antibody

Images

  • Immunohistochemical analysis of human testis tissue labeling OST beta with ab121285 at 1/50 dilution.
  • Immunohistochemical analysis of human kidney tissue labeling OST beta with ab121285 at 1/50 dilution.
  • Immunohistochemical analysis of human liver tissue labeling OST beta with ab121285 at 1/50 dilution. This showes no positivity as expected.
  • Immunohistochemical analysis of human small intestine tissue labeling OST beta with ab121285 at 1/50 dilution.
  • Lane 1: Marker [kDa] 250; 130; 95; 72; 55; 36; 28; 17; 10
    Lane 2: Negative control (vector only transfected HEK293T lysate)
    Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells. Lane 1: Marker [kDa] 250; 130; 95; 72; 55; 36; 28; 17; 10
    Lane 2: Negative control (vector only transfected HEK293T lysate)
    Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.

References

This product has been referenced in:

  • Wang C  et al. Morin protects glucocorticoid-induced osteoporosis through regulating the mitogen-activated protein kinase signaling pathway. J Nat Med 72:929-936 (2018). Read more (PubMed: 30043216) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (Huh-7 human hepatocyte-derived cell line)
Permeabilization
Yes - Triton X-100 0.1%
Specification
Huh-7 human hepatocyte-derived cell line
Blocking step
Serum as blocking agent for 17 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 4°C
Fixative
Formaldehyde

Melina Malinen

Verified customer

Submitted Sep 15 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up