Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC51B
  • Host species

    Rabbit
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC51B aa 57-128. Cytoplasmic domain.
    Sequence:

    RSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQV ELELKERDVLSVFLPDVPETES


    Database link: Q86UW2

  • Positive control

    • ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as OST-beta

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Target

  • Function

    Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids.
  • Tissue specificity

    Widely expressed with a high expression in ileum. Expressed in testis, colon, liver, small intestine, kidney, ovary and adrenal gland; and at low levels in heart, lung, brain, pituitary, thyroid gland, uterus, prostate, mammary gland and fat.
  • Sequence similarities

    Belongs to the OST-beta family.
  • Cellular localization

    Cell membrane. Mainly restricted to the lateral and basal membranes of ileal enterocytes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Organic solute transporter subunit beta antibody
    • OST-beta antibody
    • OSTB antibody
    • OSTB_HUMAN antibody

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling SLC51B using ab234742 at 1/100 dilution in ICC/IF analysis. The secondary antibody was Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L).

References

ab234742 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234742.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up