Overview

  • Product name

    SLC5A8/AIT peptide

Description

  • Nature

    Synthetic
  • Amino Acid Sequence
    • Sequence

      GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-SLC5A8/AIT antibody (ab99064)

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as SLC5A8

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituent: dH2O

  • Reconstitution
    Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in sterile PBS

General Info

  • Alternative names

    • AIT
    • Apical iodide transporter
    • Electrogenic sodium monocarboxylate cotransporter
    • MGC125354
    • SC5A8_HUMAN
    • SLC5A8
    • SMCT
    • SMCT1
    • sodium coupled monocarboxylate transporter 1
    • Sodium iodide related cotransporter
    • Sodium iodide-related cotransporter
    • Sodium-coupled monocarboxylate transporter 1
    • solute carrier family 5 iodide transporter member 8
    • Solute carrier family 5 member 8
    see all
  • Function

    Acts as an electrogenic sodium (Na(+)) and chloride (Cl-)-dependent sodium-coupled solute transporter, including transport of monocarboxylates (short-chain fatty acids including L-lactate, D-lactate, pyruvate, acetate, propionate, valerate and butyrate), lactate, mocarboxylate drugs (nicotinate, benzoate, salicylate and 5-aminosalicylate) and ketone bodies (beta-D-hydroxybutyrate, acetoacetate and alpha-ketoisocaproate), with a Na(+):substrate stoichiometry of between 4:1 and 2:1. Catalyzes passive carrier mediated diffusion of iodide. Mediates iodide transport from the thyrocyte into the colloid lumen through the apical membrane. May be responsible for the absorption of D-lactate and monocarboxylate drugs from the intestinal tract. Acts as a tumor suppressor, suppressing colony formation in colon cancer, prostate cancer and glioma cell lines. May play a critical role in the entry of L-lactate and ketone bodies into neurons by a process driven by an electrochemical Na(+) gradient and hence contribute to the maintenance of the energy status and function of neurons.
  • Tissue specificity

    Expressed in normal thyroid, localized at the apical pole of thyroid cells facing the colloid lumen, but expression profoundly decreased in thyroid carcinomas. Expressed in normal colon but absent in colon aberrant crypt foci and colon cancers. Present in normal kidney cortex, brain, prostate, gastric mucosa and breast tissue but was significantly down-regulated in primary gliomas, gastric cancer, prostate tumors and breast tumors.
  • Sequence similarities

    Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
  • Cellular localization

    Apical cell membrane. Expressed at the apical membrane of normal tall thyrocytes and of colonic epithelial cells.
  • Information by UniProt

References

ab117479 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up