Overview

  • Product name

    Anti-SLC6A16 antibody
  • Description

    Rabbit polyclonal to SLC6A16
  • Host species

    Rabbit
  • Specificity

    ab201294 detects endogenous levels of SLC6A16.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human SLC6A16 aa 242-287. The exact sequence is proprietary.
    Sequence:

    PSIYFWYQQALKASDRIEDGGSPVYSLVLPFFLCWCLVGAFMINGL


    Database link: Q9GZN6

  • Positive control

    • HEK293T and rat H9C2 cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab201294 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201294 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 82 kDa.

Target

  • Tissue specificity

    Highly expressed in peripheral tissues, particularly in testis, pancreas, and prostate.
  • Sequence similarities

    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A16 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • NT5 antibody
    • NTT5 antibody
    • Orphan sodium- and chloride-dependent neurotransmitter transporter NTT5 antibody
    • S6A16_HUMAN antibody
    • SLC6A16 antibody
    • solute carrier family 6 (neurotransmitter transporter), member 16 antibody
    • Solute carrier family 6 member 16 antibody
    see all

Images

  • All lanes : Anti-SLC6A16 antibody (ab201294)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : H9C2 whole cell lysate

    Predicted band size: 82 kDa

References

ab201294 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201294.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up