Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC6A18
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC6A18 aa 312-394.
    Sequence:

    GFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRV AQLPLKACLLEDFLDKSASGPGLAFVVFTETDL


    Database link: Q96N87

  • Positive control

    • IHC-P: Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    SLC6A18 (solute carrier family 6, member 18) belongs to the sodium:neurotransmitter symporter (SNF) family. The SLC6 family of proteins act as specific transporters for neurotransmitters, amino acids, and osmolytes like betaine, taurine, and creatine. The specific function of SLC6A18 function remains unknown. It is abundantly expressed in kidney, but is not expressed in the intestine.
  • Cellular localization

    Membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • FLJ31236 antibody
    • Sodium and chloride dependent transporter XTRP2 antibody
    • Sodium channel like protein antibody
    • Sodium dependent neutral amino acid transporter B(0)AT3 antibody
    • Solute carrier family 6 (neurotransmitter transporter) member 18 antibody
    • Solute carrier family 6 (neutral amino acid transporter), member 18 antibody
    • Solute carrier family 6 member 18 antibody
    • System B(0) neutral amino acid transporter AT3 antibody
    • Xtrp 2 antibody
    • Xtrp2 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for SLC6A18 with ab224249 (1/500) in immunohistochemical analysis.

References

ab224249 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up