Overview

  • Product name

  • Description

    Rabbit polyclonal to Slc6a6/Taut
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog
  • Immunogen

    Recombinant fragment corresponding to Human Slc6a6/Taut aa 1-49.
    Sequence:

    MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEAEGKPPQREKWSSKID


    Database link: P31641

  • Positive control

    • WB: Human placenta lysate; HeLa whole cell lysate (ab150035). IHC-P: Human brain and placenta tissues. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as Slc6a6

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab236898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 70 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Required for the uptake of taurine. Transports both taurine and beta-alanine which requires sodium ions. Chloride ions are necessary for optimal uptake.
  • Tissue specificity

    Expressed abundantly in placenta and skeletal muscle, at intermediate levels in heart, brain, lung, kidney and pancreas and at low levels in liver.
  • Sequence similarities

    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A6 subfamily.
  • Post-translational
    modifications

    Down-regulated upon Ser-322 phosphorylation.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC10619 antibody
    • MGC131729 antibody
    • OTTHUMP00000208177 antibody
    • OTTHUMP00000208180 antibody
    • SC6A6_HUMAN antibody
    • SLC6A6 antibody
    • Sodium- and chloride-dependent taurine transporter antibody
    • Solute carrier family 6 (neurotransmitter transporter, taurine), member 6 antibody
    • Solute carrier family 6 member 6 antibody
    • TAUT antibody
    see all

Images

  • All lanes : Anti-Slc6a6/Taut antibody (ab236898) at 1/500 dilution

    Lane 1 : Human placenta lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 70 kDa

  • Paraffin-embedded human brain tissue stained for Slc6a6/Taut using ab236898 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for Slc6a6/Taut using ab236898 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Slc6a6/Taut (green) using ab236898 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up