Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC7A14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human SLC7A14 aa 457-548.
    Sequence:

    ADCEKEACSPVSEGDEFSGPATNTCGAKNLPSLGDNEMLIGKSDKSTYNV NHPNYGTVDMTTGIEADESENIYLIKLKKLIGPHYYTMRIRL


    Database link: Q8TBB6

  • Positive control

    • IHC-P: Human prostate tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224572 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    SLC7A14 (Solute carrier family 7 member 14) is thought to be a cationic amino acid transporter, belonging to the amino acid-polyamine-organocation (APC) superfamily.
  • Cellular localization

    Membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • KIAA1613 antibody
    • PPP1R142 antibody
    • Probable cationic amino acid transporter antibody
    • Protein phosphatase 1 regulatory subunit 142 antibody
    • Solute carrier family 7 (cationic amino acid transporter y+ system) member 14 antibody
    • Solute carrier family 7 member 14 antibody
    see all

Images

  • Paraffin-embedded human prostate tissue stained for SLC7A14 using ab224572 at 1/1000 dilution in immunohistochemical analysis.

References

ab224572 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224572.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up