Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC7A2/CAT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human SLC7A2/CAT2 aa 215-264 (internal sequence).
    Sequence:

    VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC


    Database link: NP_001008539

  • Positive control

    • OVCAR3 cell lysate.
  • General notes

     This product was previously labelled as SLC7A2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab98997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 72 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). Plays a regulatory role in classical or alternative activation of macrophages.
  • Tissue specificity

    Expressed at high levels in the skeletal muscle, placenta and ovary. Expressed at intermediate levels in the liver and pancreas and at low levels in the kidney and heart.
  • Sequence similarities

    Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATRC2 antibody
    • 20.5 antibody
    • Amino acid transporter, cationic 2 (low affinity) antibody
    • ATRC 2 antibody
    • CAT 2 antibody
    • CAT-2 antibody
    • CAT2 antibody
    • Cat2a antibody
    • Cat2b antibody
    • Cationic amino acid transporter 2A antibody
    • cationic amino acid transporter, y+ system; low affinity cationic amino acid transporter 2 antibody
    • CTR2_HUMAN antibody
    • HCAT 2 antibody
    • HCAT2 antibody
    • Low affinity cationic amino acid transporter 2 antibody
    • OTTHUMP00000216432 antibody
    • OTTHUMP00000216433 antibody
    • OTTMUSP00000041667 antibody
    • OTTMUSP00000041669 antibody
    • RCAT2 antibody
    • SLC7A 2 antibody
    • Slc7a2 antibody
    • Solute carrier family 7 member 2 antibody
    • T cell early activation protein antibody
    • Tea antibody
    see all

Images

  • Anti-SLC7A2/CAT2 antibody (ab98997) at 1 µg/ml + OVCAR3 cell lysate at 10 µg

    Predicted band size: 72 kDa



    Gel concentration 12%

References

ab98997 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up