Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC7A6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human SLC7A6 aa 473-515.
    Sequence:

    ESRRPLFIRNVLAAITRGTQQLCFCVLTELDVAEEKKDERKTD


    Database link: Q92536

  • Positive control

    • WB: Mouse heart tissue lysate. IHC-P: Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 57 kDa.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    SLC7A6 is involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. It also acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids.
  • Cellular localization

    Basolateral cell membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • AI643885 antibody
    • Cationic amino acid transporter y+ system antibody
    • DKFZp686K15246 antibody
    • KIAA0245 antibody
    • LAT 2 antibody
    • LAT3 antibody
    • Solute carrier family 7 (cationic amino acid transporter y+ system) member 6 antibody
    • Solute carrier family 7 member 6 antibody
    • y(+)L type amino acid transporter 2 antibody
    • Y+L amino acid transporter 2 antibody
    • y+LAT 2 antibody
    • Y+LAT2 antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for SLC7A6 using ab235054 at 1/100 dilution in immunohistochemical analysis.

  • Anti-SLC7A6 antibody (ab235054) at 1/500 dilution + Mouse heart tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 57 kDa

References

ab235054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up