Overview

  • Product name

  • Description

    Rabbit polyclonal to SLC7A7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human SLC7A7 aa 325-382.
    Sequence:

    NASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLC VEDIFQLI


    Database link: Q9UM01

  • Positive control

    • WB: Mouse heart, brain and kidney tissue. IHC-P: Human kidney and pancreas tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 56 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. Requires coexpression with SLC3A2/4F2hc to mediate the uptake of arginine, leucine and glutamine. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Involved in the transport of L-arginine in monocytes.
  • Tissue specificity

    Highest expression in kidney and peripheral blood leukocytes. Weaker expression is observed in lung, heart, placenta, spleen, testis and small intestine. Expressed in normal fibroblasts and those from LPI patients. Also expressed in HUVECs, monocytes, retinal pigment epithelial cells, and various carcinoma cell lines, with highest expression in a colon-carcinoma cell line.
  • Involvement in disease

    Lysinuric protein intolerance
  • Sequence similarities

    Belongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family.
  • Cellular localization

    Basolateral cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • LAT3 antibody
    • LPI antibody
    • Monocyte amino acid permease 2 antibody
    • MOP-2 antibody
    • MOP2 antibody
    • SLC7A 7 antibody
    • Slc7a7 antibody
    • Solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 antibody
    • Solute carrier family 7 member 7 antibody
    • y(+)L type amino acid transporter 1 antibody
    • y(+)L-type amino acid transporter 1 antibody
    • Y+L amino acid transporter 1 antibody
    • y+LAT-1 antibody
    • Y+LAT1 antibody
    • YLAT1_HUMAN antibody
    see all

Images

  • All lanes :

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Mouse kidney tissue lysate
    Lane 3 : Mouse brain tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 56 kDa

  • Paraffin-embedded human kidney tissue stained for SLC7A7 using ab236669 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling SLC7A7 using ab236669 at 1/100 dilution in ICC/IF analysis. Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) was used as the secondary antibody.

  • Paraffin-embedded human pancreas tissue stained for SLC7A7 using ab236669 at 1/100 dilution in immunohistochemical analysis.

References

ab236669 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up