Overview

  • Product name

    Anti-SLCO1B3/OATP1B3 antibody
    See all SLCO1B3/OATP1B3 primary antibodies
  • Description

    Rabbit polyclonal to SLCO1B3/OATP1B3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLCO1B3/OATP1B3 aa 648-695.
    Sequence:

    KKKFQGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDM


    Database link: Q9NPD5

  • Positive control

    • IHC-P: Human liver and liver cancer tissue. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as SLCO1B3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab222900 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Mediates the Na(+)-independent uptake of organic anions such as 17-beta-glucuronosyl estradiol, taurocholate, triiodothyronine (T3), leukotriene C4, dehydroepiandrosterone sulfate (DHEAS), methotrexate and sulfobromophthalein (BSP). Involved in the clearance of bile acids and organic anions from the liver.
  • Tissue specificity

    Highly expressed in liver, in particular at the basolateral membrane of hepatocytes near the central vein. Not detected in other tissues. Highly expressed in some cancer cell lines derived from colon, pancreas, liver and gall bladder.
  • Involvement in disease

    Hyperbilirubinemia, Rotor type
  • Sequence similarities

    Belongs to the organo anion transporter (TC 2.A.60) family.
    Contains 1 Kazal-like domain.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Basolateral cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • HBLRR antibody
    • Liver-specific organic anion transporter 2 antibody
    • LST-2 antibody
    • LST-3TM13 antibody
    • LST3 antibody
    • OATP-8 antibody
    • OATP1B3 antibody
    • Organic anion transporter 8 antibody
    • Organic anion-transporting polypeptide 8 antibody
    • SLC21A8 antibody
    • SLCO1B3 antibody
    • SO1B3_HUMAN antibody
    • Solute carrier family 21 member 8 antibody
    • Solute carrier organic anion transporter family member 1B3 antibody
    see all

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for SLCO1B3/OATP1B3 (green) using ab222900 (1/100 dilution) in ICC/IF. Secondary: Alexa Fluor 488®-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin embedded human liver cancer tissue stained for SLCO1B3/OATP1B3 with ab222900 (1/100 dilution) in immunohistochemical analysis.

  • Paraffin embedded human liver tissue stained for SLCO1B3/OATP1B3 with ab222900 (1/100 dilution) in immunohistochemical analysis.

References

ab222900 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222900.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up