Anti-SLCO1B3/OATP1B3 antibody [CL3770] (ab242368)
Key features and details
- Mouse monoclonal [CL3770] to SLCO1B3/OATP1B3
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-SLCO1B3/OATP1B3 antibody [CL3770]
See all SLCO1B3/OATP1B3 primary antibodies -
Description
Mouse monoclonal [CL3770] to SLCO1B3/OATP1B3 -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SLCO1B3/OATP1B3 aa 652-701.
Sequence:QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
Database link: Q9NPD5 -
Positive control
- IHC-P: Human liver tissue.
-
General notes
This product was previously labelled as SLCO1B3
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
Purified from TCS. -
Clonality
Monoclonal -
Clone number
CL3770 -
Isotype
IgG1
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab242368 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Mediates the Na(+)-independent uptake of organic anions such as 17-beta-glucuronosyl estradiol, taurocholate, triiodothyronine (T3), leukotriene C4, dehydroepiandrosterone sulfate (DHEAS), methotrexate and sulfobromophthalein (BSP). Involved in the clearance of bile acids and organic anions from the liver. -
Tissue specificity
Highly expressed in liver, in particular at the basolateral membrane of hepatocytes near the central vein. Not detected in other tissues. Highly expressed in some cancer cell lines derived from colon, pancreas, liver and gall bladder. -
Involvement in disease
Hyperbilirubinemia, Rotor type -
Sequence similarities
Belongs to the organo anion transporter (TC 2.A.60) family.
Contains 1 Kazal-like domain. -
Post-translational
modificationsN-glycosylated. -
Cellular localization
Basolateral cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 28234 Human
- Omim: 605495 Human
- SwissProt: Q9NPD5 Human
- Unigene: 504966 Human
-
Alternative names
- HBLRR antibody
- Liver-specific organic anion transporter 2 antibody
- LST-2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLCO1B3/OATP1B3 antibody [CL3770] (ab242368)
Formalin-fixed, paraffin-embedded human liver tissue stained for SLCO1B3/OATP1B3 with ab242368 at a 1:200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLCO1B3/OATP1B3 antibody [CL3770] (ab242368)
Negative control - Formalin-fixed, paraffin-embedded human pancreas tissue stained for SLCO1B3/OATP1B3 with ab242368 at a 1:200 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab242368 has not yet been referenced specifically in any publications.