Overview

  • Product name

    Anti-SLCO2B1/OATP2B1 antibody
    See all SLCO2B1/OATP2B1 primary antibodies
  • Description

    Rabbit polyclonal to SLCO2B1/OATP2B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human SLCO2B1/OATP2B1 aa 36-85 (N terminal).
    Sequence:

    DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ


    Database link: NP_009187

  • Positive control

    • HepG2 cell lysate
  • General notes

     This product was previously labelled as SLCO2B1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab83532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 77 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    SLCO2B1 (solute carrier organic anion transporter family member 2B1), or Organic anion transporter B (OATP-B) mediates sodium-independent transport of organic anions. Unlike other related proteins, SLCO2B1 is expressed in many tissues, including liver, placenta, brain, heart and intestine. SLCO2B1 plays a role in the uptake of steroids and a number of drugs such as statins.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • Moat 1 antibody
    • Moat1 antibody
    • Multispecific organic anion transporter 1 antibody
    • Multispecific organic anion transporter1 antibody
    • OATP 2B1 antibody
    • OATP B antibody
    • OATP RP2 antibody
    • OATP2 B1 antibody
    • OATP2B1 antibody
    • OATPB antibody
    • OATPRP 2 antibody
    • OATPRP2 antibody
    • Organic anion transporter B antibody
    • Organic anion transporter polypeptide related protein 2 antibody
    • Organic anion transporter polypeptide related protein2 antibody
    • SLC 21A9 antibody
    • SLC2 1A9 antibody
    • SLC21 A9 antibody
    • SLC21A9 antibody
    • SLCO 2B1 antibody
    • SLCO2 B1 antibody
    • SO 2B1 antibody
    • SO2 B1 antibody
    • SO2B1 antibody
    • Solute carrier family 21 (organic anion transporter), member 9 antibody
    • Solute carrier family 21 member 9 antibody
    • Solute carrier organic anion transporter family member 2B1 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung tissue labelling SLCO2B1/OATP2B1 with ab83532 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the membrane of alveolar type I cells. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - SLCO2B1/OATP2B1. Right - Merge.

  • Anti-SLCO2B1/OATP2B1 antibody (ab83532) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 77 kDa
    Observed band size: 77 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Riha J  et al. Resveratrol and its major sulfated conjugates are substrates of organic anion transporting polypeptides (OATPs): impact on growth of ZR-75-1 breast cancer cells. Mol Nutr Food Res 58:1830-42 (2014). Read more (PubMed: 24996158) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (overexpressed HEK293 cells)
Loading amount
60 µg
Specification
overexpressed HEK293 cells
Gel Running Conditions
Reduced Denaturing
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Aug 11 2011

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up